PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10043451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 258aa    MW: 29941.2 Da    PI: 9.9416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10043451genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      Lus10043451  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding35.32.7e-1160103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
      Lus10043451  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
CDDcd001671.29E-111053No hitNo description
PfamPF139217.3E-141070No hitNo description
SuperFamilySSF466899.17E-2233107IPR009057Homeodomain-like
CDDcd116592.66E-3155106No hitNo description
Gene3DG3DSA:1.10.10.605.0E-1557104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD DNYEPSDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDARQR RRKRKGIDYN SEIPFEKRPP PGFYDVADED RTVEQPTFAT  240
NIKKEEVKVD ASCTTDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10932242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDARQRRRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015875524.11e-161PREDICTED: cell division cycle 5-like protein
RefseqXP_015875562.11e-160PREDICTED: cell division cycle 5-like protein
RefseqXP_007030429.11e-159Cell division cycle 5 isoform 3
RefseqXP_007208379.11e-158hypothetical protein PRUPE_ppa000753mg
SwissprotP929481e-152CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A061F1J81e-159A0A061F1J8_THECC; Cell division cycle 5 isoform 3
TrEMBLA0A0A0M0E81e-159A0A0A0M0E8_CUCSA; Uncharacterized protein
STRINGPOPTR_0013s04340.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.11e-145cell division cycle 5